DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and modSP

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:285 Identity:78/285 - (27%)
Similarity:127/285 - (44%) Gaps:50/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIV--NGK---AKCSGSLINHRFVLTAAHCV 87
            :.:||:......:.:...|..::|.:   ||.|.:.|  |.|   .:|.|||:....|:||||||
  Fly   355 EQDCGQLATPIKQFSSGGYTINNTVV---PWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCV 416

  Fly    88 FREAMQVHLGDFDAW---------NPGQNCSSGARLSNAYCVRIDKKIVHAGF-GKIQAQQYDIG 142
            :.|..::.. .:|.:         |.|:......|..    ||:.:  :..|: |:.:....|:.
  Fly   417 YDEGTRLPY-SYDTFRVIAAKFYRNYGETTPEEKRRD----VRLIE--IAPGYKGRTENYYQDLA 474

  Fly   143 LLRMQHAVQYSDFVRPICLL---INEPVAAIDRFQLTVWGTTAE---DFRSIPRVLK-HSVGDRI 200
            ||.:....:.|..:||||:.   ..|..:..|..|....|...|   :.:.:|.|.| :||..|.
  Fly   475 LLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNIENKHELQFVPAVSKSNSVCRRN 539

  Fly   201 DRELCTLKFQQQVDESQICVHTE-TSHACKGDSGGPFSAKILYG-----GTYRTFQFGII--IFG 257
            .|::...||         |:.|: .|.||:|||||.|::::...     .|.|.|.||:|  ...
  Fly   540 LRDIQADKF---------CIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPN 595

  Fly   258 LSSCA-GLSVCTNVTFYMDWIWDAL 281
            ...|| .|:|.||:..:.|.|.:|:
  Fly   596 ADQCAHSLTVMTNIQHFEDMILNAM 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 72/250 (29%)
Tryp_SPc 57..277 CDD:238113 72/250 (29%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 74/263 (28%)
Tryp_SPc 371..591 CDD:304450 66/238 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.