DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG8870

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:277 Identity:83/277 - (29%)
Similarity:129/277 - (46%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGRS--LPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGK--------AKCSGSLINHRFVLTAAH 85
            ||:|  .||..|:...|.|         ||:..::...|        .||.|||||:.:||||||
  Fly    77 CGQSRRKPTKGKIPALNEF---------PWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAH 132

  Fly    86 CVFREAMQ-------VHLGDFD-AWNPGQNCSSGAR-LSNAYC-VRIDKKIVHAGFGKIQAQQYD 140
            ||....|.       |.||:.: :.||.:...:|.| .:..|. :.:|:.|.|..|.:.:....|
  Fly   133 CVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLIND 197

  Fly   141 IGLLRMQHAVQYSDFVRPICLLINEPVAAIDR-FQLTVWGTTAEDFRSIPRVLKHSVGDRIDREL 204
            |.|:|::..|:|:..::||||...:.:||..| ||.:.|....:...| ..:|:..:.:| ..::
  Fly   198 IALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIAS-EVLLRSFIAER-HPDV 260

  Fly   205 CTLKFQQQVDESQICV----HTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLS 265
            |...:...:. ||||.    ..:||   .||||||....::.|....|:..|||.:|...|. |.
  Fly   261 CKSNYDFNLG-SQICAGGLDGNDTS---PGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCV-LK 320

  Fly   266 VC-----TNVTFYMDWI 277
            .|     |..:::.:||
  Fly   321 TCKPAFYTKTSYFFEWI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 73/247 (30%)
Tryp_SPc 57..277 CDD:238113 73/247 (30%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 77/261 (30%)
Tryp_SPc 93..337 CDD:214473 75/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.