DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG3916

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:256 Identity:68/256 - (26%)
Similarity:106/256 - (41%) Gaps:75/256 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKAK----CSGSLINHRFVLTAAHCVFR---EAMQVHLGDFDAWNPGQNCSSGARL 114
            |:.||:.:..:.:    |.||:::.:.|||||||:.:   |.:.|.:|..: |..|     |.| 
  Fly    42 PFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTLN-WKAG-----GLR- 99

  Fly   115 SNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAI-----DRF- 173
                 .|:..|.||..:........||.|::          |.|...|....::.|     ||. 
  Fly   100 -----HRLVTKHVHPQYSMNPRIINDIALVK----------VTPPFRLERSDISTILIGGSDRIG 149

  Fly   174 -----QLTVWGTT--------------AEDFRSIPRVLKHSVGDRIDR-ELCTLKFQQQVDESQI 218
                 :||.||:|              |.::|:|.....:..|.|:.| |:|.|..|.|      
  Fly   150 EKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDCNQKGFRVTRNEICALAVQGQ------ 208

  Fly   219 CVHTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA--GLSVCTNVTFYMDWI 277
                   .||.||||||    ::..|. :....||:.:|.|:||  ...|.|.|:.::.:|
  Fly   209 -------GACVGDSGGP----LIRPGK-QPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPYI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 67/254 (26%)
Tryp_SPc 57..277 CDD:238113 67/254 (26%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 67/254 (26%)
Tryp_SPc 31..260 CDD:238113 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.