DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG17404

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:241 Identity:63/241 - (26%)
Similarity:92/241 - (38%) Gaps:69/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVR-IDKK-------- 125
            |.||:|....:||||||.                .|.|.|   |:|....:| :::|        
  Fly    65 CGGSIIAPNRILTAAHCC----------------QGLNAS---RMSVVAGIRGLNEKGSRSQVLS 110

  Fly   126 -IVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAID-RFQ------------LT 176
             .:|..:.::...  |:.:|.          ::|...|.|..::||: |.|            ||
  Fly   111 YSIHPKYQELVTS--DLAVLS----------IKPPLKLNNSTISAIEYRSQGKDFVGGGVPVTLT 163

  Fly   177 VWGTTAE------DFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGP 235
            .||....      |..:.|.||:......|....|.....:.|.:::||.......||.||||||
  Fly   164 GWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNAGMESVTDTEICARGPFRGACSGDSGGP 228

  Fly   236 FSAKILYGGTYRTFQFGIIIFGLSSCAGL----SVCTNVTFYMDWI 277
            ...:...|    ..|.||:.:||..| ||    .|.|.|:.:.|||
  Fly   229 LVMESKNG----LQQVGIVSYGLVVC-GLYISPDVYTRVSTFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 61/239 (26%)
Tryp_SPc 57..277 CDD:238113 61/239 (26%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 61/239 (26%)
Tryp_SPc 35..269 CDD:238113 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.