DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG4914

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:254 Identity:79/254 - (31%)
Similarity:114/254 - (44%) Gaps:50/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SSTDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCV--FREAM-QVHLGDFDAWNPGQNCSS 110
            ::|.:...||:..:....:..|.|:|||.|:||||||||  |...| :|..|:.|      .|:.
  Fly   132 TTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHD------RCND 190

  Fly   111 GARLSNAYCVR-IDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQ 174
            ..|....:.:| ..:|...:.|..      ||.|||:...|..:.|:|||||      ..:::.|
  Fly   191 KERPETRFVLRAFSQKFSFSNFDN------DIALLRLNDRVPITSFIRPICL------PRVEQRQ 243

  Fly   175 ---------LTVWGTTAEDFRSIPRVLKHSVG-DRIDRELC---TLKFQQQVDESQIC-----VH 221
                     .|.|||..||.:  |..|...|. ..:|.:.|   |...|:.:.::.:|     |.
  Fly   244 DLFVGTKAIATGWGTLKEDGK--PSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVG 306

  Fly   222 TETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLS---VCTNVTFYMDWI 277
            ...|  |:||||||...  |.....|..|.||:.:| :.||..:   |.|.||.|:|||
  Fly   307 GRDS--CQGDSGGPLVR--LRPDDKRFEQIGIVSWG-NGCARPNYPGVYTRVTKYLDWI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 76/244 (31%)
Tryp_SPc 57..277 CDD:238113 76/244 (31%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 77/252 (31%)
Tryp_SPc 128..363 CDD:238113 79/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.