DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG10663

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:237 Identity:68/237 - (28%)
Similarity:107/237 - (45%) Gaps:25/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGK-AKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCV 120
            ||.|:::...| |.|.|:||..|:|||||||| |:.:.|.:|:.:.     |...|..:.    :
  Fly   519 PWQVAILNRFKEAFCGGTLIAPRWVLTAAHCV-RKVLFVRIGEHNL-----NYEDGTEIQ----L 573

  Fly   121 RIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDR-FQLTV--WGTTA 182
            |:.|...|..|.| :....|:.|||:..||..:.::...||  .:|..|:.: ...|:  ||...
  Fly   574 RVMKSYTHPNFDK-RTVDSDVALLRLPKAVNATTWIGYSCL--PQPFQALPKNVDCTIIGWGKRR 635

  Fly   183 EDFRSIPRVLKHSVGDRIDRELC-TLKFQQQVDESQICVHTETSH--ACKGDSGGPFSAKILYGG 244
            ....:...||..:....|..:.| .:.:...:.::..|...:..|  .|.||||||...:.....
  Fly   636 NRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKP 700

  Fly   245 TYRTFQFGIIIFGLSSCA---GLSVCTNVTFYMDWIWDALVN 283
            .:....|||..|| ..||   ...:...|..|:||:| ::||
  Fly   701 NHPWTIFGITSFG-DGCAQRNKFGIYAKVPNYVDWVW-SVVN 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 64/229 (28%)
Tryp_SPc 57..277 CDD:238113 64/229 (28%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 64/229 (28%)
Tryp_SPc 507..735 CDD:238113 64/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.