DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and proca

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_956650.1 Gene:proca / 393327 ZFINID:ZDB-GENE-060824-5 Length:434 Species:Danio rerio


Alignment Length:289 Identity:75/289 - (25%)
Similarity:124/289 - (42%) Gaps:63/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DAECGR-SLPTNAKLTWWNYFDSSTDIQANPWIV-------------SVIVN--GKAKCSGSLIN 76
            ||.||: .:|.:|      |.:....: ..||::             ::|:|  |:..|.|.||:
Zfish   170 DASCGQIRIPKSA------YANKPKPV-LQPWVMGGNVGKRGESPWQALILNHLGRFHCGGVLID 227

  Fly    77 HRFVLTAAHCVFREA-MQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYD 140
            ..:|||||||:...: ..|.|||:..:.     ..|:.::    :.:.:.|.|..:..|.... |
Zfish   228 ENWVLTAAHCLETSSKFSVRLGDYQRFK-----FEGSEVT----LPVKQHISHPQYNPITVDN-D 282

  Fly   141 IGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQL---------TVWGTTAEDFRSIPRVLKHSV 196
            |.|||:...|::|.::.|.||    |...:.:..|         |.||...:...|....|.:..
Zfish   283 IALLRLDGPVKFSTYILPACL----PSLELAKRMLHRNGTVTIITGWGKNNQSATSYNSTLHYVE 343

  Fly   197 GDRIDRELCTLKFQQQVDESQIC--VHTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLS 259
            ...:|.:.|:......:.::.:|  |..:...||:||||||...  |:..|:  |..|::.:| .
Zfish   344 LPIVDNKECSRHMMNNLSDNMLCAGVLGQVKDACEGDSGGPMMT--LFHDTW--FLVGLVSWG-E 403

  Fly   260 SCA---GLSVCTNVTFYMDWI------WD 279
            .|.   .|.:.|.|..|:|||      ||
Zfish   404 GCGQRDKLGIYTKVASYLDWIDSVRQGWD 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 64/249 (26%)
Tryp_SPc 57..277 CDD:238113 64/249 (26%)
procaNP_956650.1 GLA 23..84 CDD:214503
EGF_CA 85..119 CDD:238011
FXa_inhibition 128..165 CDD:291342
Tryp_SPc 195..427 CDD:238113 64/250 (26%)
Tryp_SPc 197..424 CDD:214473 62/245 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.