DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG14990

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:329 Identity:84/329 - (25%)
Similarity:124/329 - (37%) Gaps:85/329 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILFASLFLGSREGSA--------FLLDAE------CGRSLP----TNAKLTWWNYFDSSTDIQ 54
            ||:.|.....|..||.|        |..:.:      ||.|.|    .|.|:.    .|.||..|
  Fly    11 LLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPNGLVANVKVP----KDYSTPGQ 71

  Fly    55 ANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDA--------WNPGQNCSSG 111
            . ||:|::...||...:||||....|||||..|        :|..||        ||.||.    
  Fly    72 F-PWVVALFSQGKYFGAGSLIAPEVVLTAASIV--------VGKTDAEIVVRAGEWNTGQR---- 123

  Fly   112 ARLSNAYCVRIDKKIVHAGFGKIQAQQY-------DIGLLRMQHAVQYSDFVRPICLLINEPVAA 169
                :.:....|:.:...    :|.:::       :|.||.:.:..:....:|.|||........
  Fly   124 ----SEFLPSEDRPVARV----VQHREFSYLLGANNIALLFLANPFELKSHIRTICLPSQGRSFD 180

  Fly   170 IDRFQLTVWGTTA---EDFRSIPRVLKHSVGDRIDRELC-------TLKFQQQVDESQICVHTET 224
            ..|..:|.||..|   |::.:|.:.::..:   |:|..|       .|.....:..|.||...|.
  Fly   181 QKRCLVTGWGKVAFNDENYSNIQKKIELPM---INRAQCQDQLRNTRLGVSFDLPASLICAGGEK 242

  Fly   225 SHA-CKGDSGG----PFSAKILYGGTYRTFQFGIIIFGLSSCAG---LSVCTNVTFYMDWIWDAL 281
            ... |.||.|.    |..|     ...|..|.||:.:|: .|..   .:|.|||..:.|||::.:
  Fly   243 DAGDCLGDGGSALFCPMEA-----DPSRYEQAGIVNWGI-GCQEENVPAVYTNVEMFRDWIYEHM 301

  Fly   282 VNLS 285
            ...|
  Fly   302 AQNS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/252 (25%)
Tryp_SPc 57..277 CDD:238113 63/252 (25%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 68/262 (26%)
Tryp_SPc 67..297 CDD:214473 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.