DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and KLK2

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_005542.1 Gene:KLK2 / 3817 HGNCID:6363 Length:261 Species:Homo sapiens


Alignment Length:241 Identity:67/241 - (27%)
Similarity:113/241 - (46%) Gaps:32/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNA-- 117
            :.||.|:|..:|.|.|.|.|::.::|||||||: ::..||.||..:.:.| ::......:|::  
Human    35 SQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCL-KKNSQVWLGRHNLFEP-EDTGQRVPVSHSFP 97

  Fly   118 ---YCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWG 179
               |.:.:.|   |......:...:|:.|||:....:.:|.|:.:.|...||......: .:.||
Human    98 HPLYNMSLLK---HQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCY-ASGWG 158

  Fly   180 T-TAEDF---RSIPRVLKHSVGDRIDRELCTLKFQQQVDESQIC--VHTETSHACKGDSGGPFSA 238
            : ..|:|   ||:..|..|    .:..::|...:.::|.|..:|  :.|.....|.||||||   
Human   159 SIEPEEFLRPRSLQCVSLH----LLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGP--- 216

  Fly   239 KILYGGTYRTFQFGIIIFGLSSCA---GLSVCTNVTFYMDWIWDAL 281
             ::..|..:    ||..:|...||   ..:|.|.|..|..||.|.:
Human   217 -LVCNGVLQ----GITSWGPEPCALPEKPAVYTKVVHYRKWIKDTI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 64/233 (27%)
Tryp_SPc 57..277 CDD:238113 64/233 (27%)
KLK2NP_005542.1 Tryp_SPc 25..256 CDD:238113 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.