DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and KLK1

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:298 Identity:74/298 - (24%)
Similarity:118/298 - (39%) Gaps:60/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILFASLFLGSREGSAFLLDAECGRSLPTNAKLT--WWNYFDSSTDIQANPWIVSVIVNGKAKCS 71
            |:|..:|.||.           .|.:.|..:::.  |      ..:..:.||..::......:|.
Human     4 LVLCLALSLGG-----------TGAAPPIQSRIVGGW------ECEQHSQPWQAALYHFSTFQCG 51

  Fly    72 GSLINHRFVLTAAHCVFREAMQVHLGD---FDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGK 133
            |.|::.::|||||||: .:..|:.||.   ||..|..|            .|.:.:...|.||..
Human    52 GILVHRQWVLTAAHCI-SDNYQLWLGRHNLFDDENTAQ------------FVHVSESFPHPGFNM 103

  Fly   134 I-------QAQQ---YDIGLLRM-QHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRS 187
            .       ||.:   :|:.|||: :.|...:|.|:.:.|...||... .....:.||:...:..|
Human   104 SLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVG-STCLASGWGSIEPENFS 167

  Fly   188 IPRVLKHSVGDRIDRELCTLKFQQQVDESQICV-HTE-TSHACKGDSGGPFSAKILYGGTYRTFQ 250
            .|..|:......:..:.|.....|:|.:..:|| |.| ....|.||||||    ::..|..:   
Human   168 FPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGP----LMCDGVLQ--- 225

  Fly   251 FGIIIFGLSSCA---GLSVCTNVTFYMDWIWDALVNLS 285
             |:..:|...|.   ..||...|..|:.||.|.:...|
Human   226 -GVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 62/238 (26%)
Tryp_SPc 57..277 CDD:238113 62/238 (26%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 65/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.