DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG30414

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:309 Identity:119/309 - (38%)
Similarity:169/309 - (54%) Gaps:35/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKVIAALLILFASLFLGSREGS-AFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIV 64
            ||.:.|.|.:|..|:.||  ||: ..|||:.||.:.|....:....   :...:.:|||:|.|: 
  Fly     1 MKFIAAGLALLVCSIQLG--EGAPGHLLDSSCGTTKPEFIPMITGG---ADAGLFSNPWMVKVL- 59

  Fly    65 NGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCS-------------------- 109
             |:..|.||||..|||||||||:....|:|.||::....||::||                    
  Fly    60 -GEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTR 123

  Fly   110 ---SGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAID 171
               ....:..:|.:.:|:||:||.:.  .....|||||||:..|||||:|||||||:...:|...
  Fly   124 FPGKDCCVPKSYELAVDRKILHADYN--LNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESP 186

  Fly   172 RFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPF 236
            .|.:|.||.|.:...|  |.|:.:.....|...|..||.:||||||||.....|.||.||||||.
  Fly   187 IFNITGWGVTNDGTPS--RRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPL 249

  Fly   237 SAKILYGGTYRTFQFGIIIFGLSSCAGLSVCTNVTFYMDWIWDALVNLS 285
            ||::.:.|::.|||:|::.:|.::|...||.||||.:.|||.:|:.:.|
  Fly   250 SAQVPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAIEDFS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 98/242 (40%)
Tryp_SPc 57..277 CDD:238113 98/242 (40%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 99/257 (39%)
Tryp_SPc 41..290 CDD:238113 99/257 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.