DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and tpr

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:248 Identity:58/248 - (23%)
Similarity:111/248 - (44%) Gaps:47/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVF---REAMQVHLGDFDAWNPGQNCSSGA 112
            |::...||:..::..|:..|:.||:|.:|:|||:|||:   :|.:.|.|.:.|.           
  Fly   133 TEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDR----------- 186

  Fly   113 RLSNAYCVRIDKK----IVHAGFGKIQAQQY--DIGLLRMQHAVQYSDFVRPICL------LINE 165
              ..::..:||:|    |.|.   |..|:.|  ||.::::...|::::.:.|:|:      ...|
  Fly   187 --KMSHMQKIDRKVAEVITHP---KYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGE 246

  Fly   166 PVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELC-TLKFQQQVDESQICVHTET--SHA 227
            .........|.|.|.|::..:.:...:       :.::.| ..::..::.::.:|...:.  ..:
  Fly   247 NGIVTGWGALKVGGPTSDTLQEVQVPI-------LSQDECRKSRYGNKITDNMLCGGYDEGGKDS 304

  Fly   228 CKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWI 277
            |:||||||.  .|:..||......|::.:| ..||..   .|...|..|..||
  Fly   305 CQGDSGGPL--HIVASGTREHQIAGVVSWG-EGCAKAGYPGVYARVNRYGTWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 55/240 (23%)
Tryp_SPc 57..277 CDD:238113 55/240 (23%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 56/246 (23%)
Tryp_SPc 127..356 CDD:238113 58/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.