DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG30283

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:282 Identity:91/282 - (32%)
Similarity:144/282 - (51%) Gaps:30/282 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVIAALLILFAS--LFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVN 65
            |:...:::|.||  :.|||..||  .|:..||....:..|:...:    :..:.:.||:..|:..
  Fly     5 KIFVVVVLLAASSVVVLGSESGS--FLEHPCGTVPISQFKILGGH----NAPVASAPWMAMVMGE 63

  Fly    66 GKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAG 130
            |...|.|:||.:|||||:|||:....::|.||..:            |.:.|....:|...||..
  Fly    64 GGFHCGGTLITNRFVLTSAHCIANGELKVRLGVLE------------REAEAQKFAVDAMFVHTD 116

  Fly   131 FGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAID----RFQLTVWGTTAEDFRSIPRV 191
            :   ...|:|:.|||:...|.|||.:.|||||::..|..||    :|:...||.|  :.||..|:
  Fly   117 Y---YFDQHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKT--ESRSSSRM 176

  Fly   192 LKHSVGDRIDRELCTLKF-QQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFGIII 255
            |:.:....:.|..|..:: .||::.:.||..:..::.|.||||||.:|.:.|......||||:..
  Fly   177 LQKTSLFNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTS 241

  Fly   256 FGLSSCAGLSVCTNVTFYMDWI 277
            ||.:.|:..:|.|||..::|||
  Fly   242 FGHADCSKATVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 76/224 (34%)
Tryp_SPc 57..277 CDD:238113 76/224 (34%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 77/241 (32%)
Tryp_SPc 43..266 CDD:238113 78/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.