DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG10764

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:291 Identity:87/291 - (29%)
Similarity:136/291 - (46%) Gaps:45/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKVIAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANP---WIVSV 62
            |:.:::..|:...:|.:...|...| |:..||  :.|..|:       |..|..|.|   |:.::
  Fly     1 MRSLVSVALLSLLTLCVTENEHFKF-LETPCG--ISTRPKI-------SGGDDAAEPNSIWMAAI 55

  Fly    63 IVNGKAKCSGSLINHRFVLTAAHCVFR-EAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKI 126
            ..:...:|.|::|:.||||:||||:.| ..:.|.||       .:|.:..|.:.....|     .
  Fly    56 FNSSDFQCGGTIIHMRFVLSAAHCLVRGYDLYVRLG-------ARNINEPAAVHTVINV-----F 108

  Fly   127 VHAGFGKIQAQQY--DIGLLRMQHAVQYSDFVRPICLLINE----PVAAIDRFQLTVWGTTAEDF 185
            ||..|   .|.:|  |||||::..::.|:..|:|||:.::.    .|..:..|:...||......
  Fly   109 VHHDF---IASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKL 170

  Fly   186 RSIPRV--LKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILY--GGTY 246
            ..:.:.  |.|     :.|..|..|....::..|||..|:....|:||||||.|..||:  ..:|
  Fly   171 SIMLQTIYLLH-----LKRNECKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSY 230

  Fly   247 RTFQFGIIIFGLSSCAGLSVCTNVTFYMDWI 277
            .. |.||:.||...|.|:.|.|:||.|:|||
  Fly   231 EV-QLGIVSFGDPECRGVGVYTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 72/233 (31%)
Tryp_SPc 57..277 CDD:238113 72/233 (31%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 76/250 (30%)
Tryp_SPc 38..263 CDD:238113 77/251 (31%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.