DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Prss48

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:304 Identity:92/304 - (30%)
Similarity:127/304 - (41%) Gaps:68/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AALLILFASLFLGSREGSAFL----LDAECGRSLPT-------NAKLTWWNYFDSSTDIQANPWI 59
            |.|.:|.. ||||:.:|| |.    |.:.|||.:.|       :|.|..|            ||.
Mouse     4 AGLKVLLL-LFLGAFQGS-FTKKKNLQSVCGRPVHTGRIVGGQDAALGRW------------PWQ 54

  Fly    60 VSVIVNGKAKCSGSLINHRFVLTAAHCV----FREAMQVHLGDFDAWNPGQNCSSGARLSNAYCV 120
            ||:..:....|.||||:..:|||||||:    :.....|.||..|.    :..|:|   ...|..
Mouse    55 VSLRFDYTHSCGGSLISDHWVLTAAHCIKKTWYSFLYSVWLGSIDR----EYSSTG---KEYYVS 112

  Fly   121 RI---DKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL-LINEPVAAIDRFQLTVWGTT 181
            ||   ||.         :..:.||.||::...|.:|..:.|||| .|::.:.......:|.||..
Mouse   113 RIAIPDKH---------RHTEADIALLKLSSRVTFSSVILPICLPNISKQLTVPASCWVTGWGQN 168

  Fly   182 AEDFRSIPRVLKHSVGDRIDRELCTLKF----------QQQVDESQICVHTETSH--ACKGDSGG 234
            .|.  ..|..|:......|..|.|...:          ::.:.|...|.....|.  :|||||||
Mouse   169 QEG--HYPSTLQELEVPVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGERQSRKDSCKGDSGG 231

  Fly   235 PFSAKILYGGTYRTFQFGIIIFGLSSCAGL-SVCTNVTFYMDWI 277
            |.|..|  .|.:|.  .|::.:||.....| .|.||||:|..||
Mouse   232 PLSCHI--DGVWRL--MGVVSWGLECGKDLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 72/240 (30%)
Tryp_SPc 57..277 CDD:238113 72/240 (30%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 75/265 (28%)
Tryp_SPc 40..274 CDD:238113 77/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.