DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG8299

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:277 Identity:78/277 - (28%)
Similarity:123/277 - (44%) Gaps:39/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAK---CSGSLI 75
            ||.||     .|||.|.....|..:|.::.........||...|:.|||.:.....   |.||:.
  Fly     2 SLRLG-----LFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIY 61

  Fly    76 NHRFVLTAAHCV-FREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQY 139
            ..|.|:|||||: .|.|..:.:      ..|||..:......   |::.|.|.|||:.| :....
  Fly    62 APRVVITAAHCIKGRYASYIRI------VAGQNSIADLEEQG---VKVSKLIPHAGYNK-KTYVN 116

  Fly   140 DIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDREL 204
            ||||:..:..::||..|:||.:.:..|.:..... ::.||..|||..::|.:|:......|::..
  Fly   117 DIGLIITREPLEYSALVQPIAVALEAPPSGAQAV-VSGWGKRAEDDEALPAMLRAVELQIIEKST 180

  Fly   205 CTLKF---QQQVDESQICV-HTE-TSHACKGDSGGPFSAK-ILYGGTYRTFQFGIIIFGLSSCA- 262
            |..::   ...|.:..:|. :.| ....|.||||||.:.. :|         .|::.:|: .|. 
  Fly   181 CGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVL---------VGVVSWGV-GCGR 235

  Fly   263 -GL-SVCTNVTFYMDWI 277
             |. .|.|:|..::|||
  Fly   236 EGFPGVYTSVNSHIDWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 64/232 (28%)
Tryp_SPc 57..277 CDD:238113 64/232 (28%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 66/245 (27%)
Tryp_SPc 28..255 CDD:238113 68/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.