DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Tmprss4

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:283 Identity:88/283 - (31%)
Similarity:135/283 - (47%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSR---EGSAFLLDA-ECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHR 78
            |||   .||...|.. :||:||.|...:   ...::|.|  :.||.||:..|.:..|.||:::|.
  Rat   220 GSRSCLSGSLVSLRCLDCGKSLKTTRVV---GGVEASAD--SWPWQVSIQYNKQHVCGGSILDHH 279

  Fly    79 FVLTAAHCVFREAMQVHLGDFDAW--NPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDI 141
            ::|||||| ||:.:     |..:|  ..|.|     :|.|:..:.: .||..|....:|.::.||
  Rat   280 WILTAAHC-FRKYL-----DVSSWKVRAGSN-----KLGNSPSLPV-AKIFIAEPNPLQPKEKDI 332

  Fly   142 GLLRMQHAVQYSDFVRPICLLINE-------PVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDR 199
            .|::::..:.:|..||||||..::       ||..|.      ||.|.|:...:...|..:....
  Rat   333 ALVKLKMPLTFSGSVRPICLPFSDEELIPTMPVWVIG------WGFTEENGGKMSDTLLQASVQV 391

  Fly   200 IDRELCTLK--FQQQVDESQICVHTET--SHACKGDSGGPFSAKILYGGTYRTFQ-FGIIIFGLS 259
            ||...|..:  :|.:|....:|..|..  ...|:||||||    ::|  .|..:| .||:.:|. 
  Rat   392 IDSARCNAEDAYQGEVTAGMLCAGTPQGGKDTCQGDSGGP----LMY--HYDKWQVVGIVSWGY- 449

  Fly   260 SCAGLS---VCTNVTFYMDWIWD 279
            .|...|   |.|.||.|:|||::
  Rat   450 GCGSPSTPGVYTKVTAYLDWIYN 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 73/236 (31%)
Tryp_SPc 57..277 CDD:238113 73/236 (31%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346 6/17 (35%)
Tryp_SPc 245..470 CDD:214473 75/254 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.