DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG8586

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:284 Identity:74/284 - (26%)
Similarity:115/284 - (40%) Gaps:62/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGRS-----LPTNAKLTWWNYFDSSTDIQ---ANPWIVSVIVNGKAK--CSGSLINHRFVLTAAH 85
            ||.|     :|.|.|      |..|.|:.   ..||:|. |..|:.:  |.|:||:.|.|:|.:|
  Fly   172 CGYSNPKGLIPDNDK------FPYSEDVSIFGEFPWMVG-IFTGRQEFLCGGTLIHPRLVVTTSH 229

  Fly    86 CVFREAMQ---VHLGDFDAWN-----PGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIG 142
            .:..|.:.   ...||:|..:     |.|..            ||.:.|:|:.|.. .:...||.
  Fly   230 NLVNETVDTLVARAGDWDLNSLNEPYPHQGS------------RIKEIIMHSEFDP-NSLYNDIA 281

  Fly   143 LLRMQHAVQYSDFVRPICL-------LINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRI 200
            ||.:...::.:..::|:||       |.|:.::.  ....|.|||.......:..|||......:
  Fly   282 LLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSV--TCYATGWGTKEAGSDKLEHVLKRINLPLV 344

  Fly   201 DRELCTLKFQQ-------QVDESQICVHTET-SHACKGDSGGPFSAKILYGGTYRTFQF-GIIIF 256
            :||.|..|.:.       ::..|.||...:. ...||||.|.|...::  .|....:|. ||:.:
  Fly   345 EREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQM--PGEMDRYQLVGIVSW 407

  Fly   257 GLSSCAG---LSVCTNVTFYMDWI 277
            |: .||.   .:|..||.....||
  Fly   408 GV-ECAVEDIPAVYVNVPHLRGWI 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/248 (25%)
Tryp_SPc 57..277 CDD:238113 63/248 (25%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 65/253 (26%)
Tryp_SPc 197..430 CDD:214473 63/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.