DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG18563

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:300 Identity:67/300 - (22%)
Similarity:112/300 - (37%) Gaps:87/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GRSLPTNAKLTWWNYFDSSTDIQANP-----------------WIVSVIVNGKAKCSGSLINHRF 79
            |...|||         |.:...|..|                 |:|::.........||||:.:.
  Fly   113 GSGAPTN---------DGAQAEQPKPTERTQPGGRCNTTGLYSWVVALFYEEVYLTGGSLISPKV 168

  Fly    80 VLTAAHCVF----REAMQVHLGDF--DAWN-PGQNCSSGARLSNAYCVRIDKKIV-HAGFGKIQA 136
            :|||||...    .:.:.|..|:|  :..| |.|           |..|:.::|| |.|| ..|:
  Fly   169 ILTAAHNTMNKMNEDRIVVRAGEFVMNTTNEPIQ-----------YEERVVERIVRHEGF-IFQS 221

  Fly   137 QQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTV--WGTTAEDFRSIPRVLKHSVGDR 199
            ...::.|:.::.....:|.:..:.|...:  |:.:..:.||  |...:...:|..|::|......
  Fly   222 GINNVALIFVKTPFVLNDRIGVLTLPSRQ--ASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTV 284

  Fly   200 IDRELCTLKFQQ-------QVDESQICVHTETSH-ACKGDSGGPFSAKILYGGTYRTF------- 249
            :||..|..:|:.       .:..|.||..:|.:. .|.|            ||.|..|       
  Fly   285 LDRTTCVAQFRNTTLGRNFDLHPSLICARSEINRDFCFG------------GGGYALFCSLGDEN 337

  Fly   250 -----QFGIIIFGLSSCAGL---SVCTNVTFYMDWIWDAL 281
                 |.||:.:|:.  .||   .:.|||..:..||::.:
  Fly   338 PHVFEQAGIVAWGMG--CGLDLPGIYTNVAMFRSWIYNRI 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 59/269 (22%)
Tryp_SPc 57..277 CDD:238113 59/269 (22%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 60/253 (24%)
Tryp_SPc 147..371 CDD:214473 58/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.