DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and SPH93

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:277 Identity:72/277 - (25%)
Similarity:118/277 - (42%) Gaps:29/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHC 86
            ||:.||...||.|.....::......|.:...| .||.|::..||:....||||....|||.||.
  Fly   224 GSSELLSPSCGMSNANGLQMVEGITIDQARPAQ-YPWAVAIFHNGQYLAGGSLIQPNVVLTVAHR 287

  Fly    87 V--FREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHA 149
            |  ....:.|..||:|..:..:...|..|       .:::.::|.|| ..::...::.||.:...
  Fly   288 VITIETELVVRAGDWDLKSDREIFLSEQR-------EVERAVIHEGF-DFKSGANNLALLFLNSP 344

  Fly   150 VQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQ--- 211
            .:.:|.:|.|||.......|..|..:..||....:.:....|||......::|.:|. ||.:   
  Fly   345 FKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCE-KFLRSTR 408

  Fly   212 -----QVDESQICVHTETSH-ACKGDSGGPFSAKI--LYGGTYRTFQFGIIIFGLSSCA--GL-S 265
                 ::.::.||...|... .|.||.|......|  ...|.|.  |.||:.:|: .|.  |: :
  Fly   409 LGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYE--QAGIVNWGV-GCGQEGIPA 470

  Fly   266 VCTNVTFYMDWIWDALV 282
            :.|.|:.:.:||.:.|:
  Fly   471 IYTEVSKFTNWITEKLL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/235 (26%)
Tryp_SPc 57..277 CDD:238113 60/235 (26%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 64/247 (26%)
Tryp_SPc 252..482 CDD:214473 61/242 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.