DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG18478

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:294 Identity:72/294 - (24%)
Similarity:113/294 - (38%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALLILFASLFLGSREGSAFLLDAE---CGRSLPTNAKLTWWNYFDSSTDIQAN----PWIVSVIV 64
            |..::.|...||..|....|...|   ||...|...|:.:     :.|:.||.    ||.::||.
  Fly     4 AWTLIVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQF-----NVTEGQAKPAEFPWTIAVIH 63

  Fly    65 NGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHA 129
            |......||||....||||||.:|.:.::..:.....|..| :.........|:.:   |.::|.
  Fly    64 NRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYG-SALEKYPFEEAFVL---KMVIHK 124

  Fly   130 GFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKH 194
            .| ..|....::.||.:......:..:..|||...:...:..|..:..||...........|||.
  Fly   125 SF-NYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKK 188

  Fly   195 SVGDRIDRELCTLKFQQQVDESQ-----------ICVHTETSH-ACKGDSGGPFSAKILYGGTYR 247
            .....:.|.:|    |.|:.:::           ||...|..: ||.||.||.....:....  :
  Fly   189 IDLPIVPRHIC----QDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDP--K 247

  Fly   248 TF-QFGIIIFGLSSCAGLSV---CTNVTFYMDWI 277
            .| |.||:.:|: .|...:|   .|:|..:..||
  Fly   248 QFEQIGIVNWGV-GCKEKNVPATYTDVFEFKPWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 56/235 (24%)
Tryp_SPc 57..277 CDD:238113 56/235 (24%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 59/243 (24%)
Tryp_SPc 50..280 CDD:214473 57/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.