DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG4650

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:289 Identity:69/289 - (23%)
Similarity:114/289 - (39%) Gaps:64/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASLFLGSREGSAFLLDAECGRSLPTNAKLT------WWNYFDSSTDIQANPWIVSVIVNGKAKCS 71
            |.|||....||:..||..||  |.||.|:.      |..|..:|..:..              |.
  Fly    10 ALLFLLPVPGSSQYLDGRCG--LLTNGKIANNISSPWMAYLHTSELLYV--------------CG 58

  Fly    72 GSLINHRFVLTAAHCV-FREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQ 135
            |::|..:.|||||||. ..|.:...:|:|    .|.:.::...||.   .::.:..:|:.:....
  Fly    59 GTVITEKLVLTAAHCTRASEQLVARIGEF----IGTDDANDTMLSE---YQVSQTFIHSLYNTTT 116

  Fly   136 AQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFR-------SIPRVLK 193
            :.. ||.:|.:...:.:|..:||||::           ..|:|....::.:       .:|....
  Fly   117 SAN-DIAILGLATDIVFSKTIRPICIV-----------WWTIWRKYIDNIQVLSGAQWGLPNDRN 169

  Fly   194 HSVGDRI------DRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFG 252
            .|...||      ...:|:......:..||.|.....|..|..|...|..|.|    |::..|..
  Fly   170 ESDAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAII----TFKNIQRY 230

  Fly   253 IIIFGLSS----CAGLSVCTNVTFYMDWI 277
            ::| |:::    |...||.|:|..:.|:|
  Fly   231 VLI-GIATTNQKCKRASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 51/237 (22%)
Tryp_SPc 57..277 CDD:238113 51/237 (22%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 56/262 (21%)
Tryp_SPc 33..258 CDD:304450 56/262 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.