DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG5390

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:277 Identity:64/277 - (23%)
Similarity:108/277 - (38%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVI-VNGKA---KCSGSLINHRFVLTAAHCVFRE- 90
            ||...|...........:...:....||::::: ..|..   :|.|:||....||||||||..: 
  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199

  Fly    91 --AMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQY-DIGLLRMQHAVQY 152
              ::.|..|::|.    |..:...|..:.|...|   |.|..|.|  ...| |:.::.::.....
  Fly   200 PSSIVVRAGEWDT----QTQTEIRRHEDRYVKEI---IYHEQFNK--GSLYNDVAVMLLESPFTL 255

  Fly   153 SDFVRPICLLINEPVAAIDRFQLTVWGTTA----EDFRSIPRVLKHSVGDRIDRELCTLKFQQQ- 212
            .:.::.:||.........||...|.||...    .:::.|.:.:...|   :..:.|....::. 
  Fly   256 QENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPV---VPEQQCETNLRETR 317

  Fly   213 ------VDESQICVHTE-TSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLS---VC 267
                  :.:|.||...| ....||||.|.|....|. |...|....||:.:|: .|..::   |.
  Fly   318 LGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIA-GQKNRFKSAGIVAWGI-GCGEVNIPGVY 380

  Fly   268 TNVTFYMDWIWDALVNL 284
            .:|.....|| ||.:.:
  Fly   381 ASVAKLRPWI-DAKLKI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 57/242 (24%)
Tryp_SPc 57..277 CDD:238113 57/242 (24%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 59/252 (23%)
Tryp_SPc 153..390 CDD:214473 57/250 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.