DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG3355

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:253 Identity:68/253 - (26%)
Similarity:113/253 - (44%) Gaps:60/253 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IQAN--PWIVSVIVNG----KAKCSGSLINHRFVLTAAHCVF--REAMQVHLGDFD--AWNPGQN 107
            :::|  || .:.:|.|    :..|.|||||.|:||||||||.  |:.:.:.|...|  :.:||  
  Fly    82 VRSNKYPW-TAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRSSRDPG-- 143

  Fly   108 CSSGARLSNAYCVRIDKKI----VHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVA 168
                          |.:|:    ||..:...:... |:.||:::..|..:..:||:||    |.|
  Fly   144 --------------IVRKVVQTTVHPNYDPNRIVN-DVALLKLESPVPLTGNMRPVCL----PEA 189

  Fly   169 --------AIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQIC---VHT 222
                    |:    :..||...|...:...:.:.:|....:.:....:::.::.|..:|   |..
  Fly   190 NHNFDGKTAV----VAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQ 250

  Fly   223 ETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA---GLSVCTNVTFYMDWI 277
            ....||:||||||.   |:..|.|:.  .|::.||. .||   ...|...|:.::|||
  Fly   251 GGKDACQGDSGGPL---IVNEGRYKL--AGVVSFGY-GCAQKNAPGVYARVSKFLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 65/245 (27%)
Tryp_SPc 57..277 CDD:238113 65/245 (27%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 66/251 (26%)
Tryp_SPc 76..305 CDD:238113 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.