DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG3117

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:300 Identity:70/300 - (23%)
Similarity:112/300 - (37%) Gaps:101/300 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SLPTNAKLTWWNYFDSSTDIQAN-------PWIVSVIVNGKAKCSGSLINHRFVLTAAHC---VF 88
            |:.|..:.::.|..|.|..:..:       ||:.::...|.....||||....||||||.   :.
  Fly    74 SVDTLLRTSYPNALDGSPQVFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLS 138

  Fly    89 REAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQH-AVQY 152
            ...:.|..|::|       .||..:|:..    :|::::     ||           |:| |..|
  Fly   139 PNDIMVRAGEWD-------LSSSEKLNPP----MDRQVI-----KI-----------MEHEAFNY 176

  Fly   153 SDFVRPICLL-INEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDR-IDRELCTL-------- 207
            |.....:.|| ::.|      |:|          |:..:.::..:.|: .||.:||:        
  Fly   177 SSGANDLALLFLDSP------FEL----------RANIQTIRLPIPDKTFDRRICTVAGWGMRSS 225

  Fly   208 ------KFQQQVD----ESQIC------------VHTETSHACKGDSGGPFSAKILYGG------ 244
                  ..||:||    ||..|            .....|..|.|...|. ....|:||      
  Fly   226 TDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGR-DVCSLFGGFALFCS 289

  Fly   245 ----TYRTFQFGIIIFGLSSCAGLSV---CTNVTFYMDWI 277
                ..|..|.||:.||: .|...:|   .|:|:.:|:||
  Fly   290 LDDDPNRYEQAGIVSFGV-GCGQANVPTTFTHVSKFMEWI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/268 (24%)
Tryp_SPc 57..277 CDD:238113 63/268 (24%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 64/278 (23%)
Tryp_SPc 95..328 CDD:214473 63/277 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.