DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG11911

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:296 Identity:74/296 - (25%)
Similarity:124/296 - (41%) Gaps:49/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKVIAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQAN--PWIVSVI 63
            ||.:...|:|...:...|::      |..:..:.:|:.|.    .:..:.|:.:.:  |:|||:.
  Fly     1 MKLITVTLVIALVAAAQGAK------LSDKLAKLVPSFAT----GFVINGTEAEPHSAPYIVSLA 55

  Fly    64 VN---GKAKCSGSLINHRFVLTAAHCVFRE-AMQVHLG-----DFDAWNPGQNCSSGARLSNAYC 119
            .|   ....|.|:|||..:::|||||:... .|.:..|     :.|.....:....|        
  Fly    56 TNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFG-------- 112

  Fly   120 VRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAED 184
             |:.:|.. .|.|     .|||.||.:..:..::::|:|..|...|.|.. ....|..||.....
  Fly   113 -RVHEKYT-GGVG-----PYDIALLHVNESFIFNEWVQPATLPSREQVHE-GETHLYGWGQPKSY 169

  Fly   185 FRSIPRVLKHSVGDRIDRELCTLKFQQQ--VDESQICVHT--ETSHACKGDSGGPFSAKILYGGT 245
            ..|..:.|:......::.|.|..:..:.  :.||.||..:  ::..||.||||||...:.....:
  Fly   170 IFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPS 234

  Fly   246 YRTFQFGIIIFGLSSCAGL----SVCTNVTFYMDWI 277
            .   ..||:.:|...| ||    |:.|.|:.|:|||
  Fly   235 E---LIGIVSWGYIPC-GLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/236 (27%)
Tryp_SPc 57..277 CDD:238113 63/236 (27%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 66/250 (26%)
Tryp_SPc 37..266 CDD:214473 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.