DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and AgaP_AGAP008996

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_552892.3 Gene:AgaP_AGAP008996 / 3291870 VectorBaseID:AGAP008996 Length:249 Species:Anopheles gambiae


Alignment Length:254 Identity:62/254 - (24%)
Similarity:104/254 - (40%) Gaps:34/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFR---EAMQVHLGD 98
            |.|....|.:     .|....|..|..::   ||..:|:|..:.:||||||..   ..:.:.||:
Mosquito    11 TKAAFGRWPW-----QISLRQWRTSTYLH---KCGAALLNENWAITAAHCVDNVPPSDLLLRLGE 67

  Fly    99 FDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLI 163
            :|.....:......|       |:.....|..|.. :..:||:.|||....|.:...:.|:|:..
Mosquito    68 YDLALEEEPYGYQER-------RVQIVASHPQFDP-RTFEYDLALLRFYEPVVFQPNIIPVCVPE 124

  Fly   164 NEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQ-----QQVDESQICVHTE 223
            |:.........:|.||...|| ..:|.||:......|:..:|...::     :.:....||...:
Mosquito   125 NDENFIGRTAFVTGWGRLYED-GPLPSVLQEVTVPVIENNICETMYRSAGYIEHIPHIFICAGWK 188

  Fly   224 TS--HACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAGLS---VCTNVTFYMDWI 277
            ..  .:|:||||||.   ::.....|....|:|.:|: .||..:   |.|.::.:.|||
Mosquito   189 KGGYDSCEGDSGGPM---VIQRTDKRFLLAGVISWGI-GCAEPNQPGVYTRISEFRDWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 56/232 (24%)
Tryp_SPc 57..277 CDD:238113 56/232 (24%)
AgaP_AGAP008996XP_552892.3 Tryp_SPc 6..243 CDD:214473 60/252 (24%)
Tryp_SPc 7..246 CDD:238113 62/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.