DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CLIPB3

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_307750.3 Gene:CLIPB3 / 3290783 VectorBaseID:AGAP003249 Length:365 Species:Anopheles gambiae


Alignment Length:259 Identity:80/259 - (30%)
Similarity:120/259 - (46%) Gaps:45/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TDIQANPWIVSVIVNGKA------KCSGSLINHRFVLTAAHCV--FREAMQVH---LGDFDAWNP 104
            |.|...|| .::|...|.      .|.|||||.|:::|||||:  .....:||   ||::|    
Mosquito   119 TQIDEFPW-TALIEFQKPDGSFGFHCGGSLINDRYIVTAAHCIKSIPRGWKVHRVRLGEWD---- 178

  Fly   105 GQNCSSGARLSNAYC------VRIDKKIVHAGFG-KIQAQQYDIGLLRMQHAVQYSDFVRPICL- 161
               .:|.....|.:|      :.|::.:||.|:. |.|:...||.|:|....|.||..|||||| 
Mosquito   179 ---LTSANDCQNEFCSDAPIDLDIEQIVVHTGYDTKDQSNANDIALIRFTRPVNYSQTVRPICLP 240

  Fly   162 ----LINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQ---QVDESQIC 219
                |.|...|.:..: ...||.| |...:..:.||..:..:..:| |...:|:   .:.::.:|
Mosquito   241 LSSSLRNRNHAGMPAY-AAGWGKT-ESATASEKKLKVEMNIKSLQE-CAPVYQRGGILLKKTHMC 302

  Fly   220 V-HTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA--GL-SVCTNVTFYMDWIWD 279
            . .......|.||||||...::  .|::  :..|::.||...|.  |: .|.|||..|:|||.|
Mosquito   303 AGGVRGKDTCSGDSGGPLMRQM--SGSW--YLIGVVSFGPQKCGAPGVPGVYTNVAEYVDWIKD 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 75/249 (30%)
Tryp_SPc 57..277 CDD:238113 75/249 (30%)
CLIPB3XP_307750.3 CLIP 37..89 CDD:288855
Tryp_SPc 112..360 CDD:214473 77/255 (30%)
Tryp_SPc 113..363 CDD:238113 80/259 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.