DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG33160

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:240 Identity:63/240 - (26%)
Similarity:99/240 - (41%) Gaps:44/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLS 115
            :.|:...::|.| ...:..|.|||:..|:|:||||||:.:    :..||..:....|      .:
  Fly    40 SSIKEEKYLVQV-TTSEELCGGSLVKPRWVITAAHCVYNK----NKNDFKIYGGASN------QA 93

  Fly   116 NAYCV--RIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVR------PICLLINEPVAAIDR 172
            ..|.|  .:|...:...|.: :....|:..||:.     ||.:.      |   |..:.|.|...
  Fly    94 GPYAVIRTVDYIAIRPDFNR-KTLNMDVAALRLN-----SDMIGANIETIP---LAAQSVPARAL 149

  Fly   173 FQLTVWG-TTAEDFRSIPRVLKHSV-GDRIDRELCTLKFQ--QQVDESQIC-VHTETSHACKGDS 232
            .:::.|| .||:..::..||  ||| .....|..|...|:  .::..|.:| .......:|.|||
  Fly   150 VKVSGWGFLTADATKTAERV--HSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDS 212

  Fly   233 GGPFSAKILYGGTYRTFQFGIIIFGLSSCAGL-SVCTNVTFYMDW 276
            |||.        .||....||:.||....:.| .:.|:|....||
  Fly   213 GGPL--------VYRGQLAGIVSFGYGCASALPGIYTSVPEIRDW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 62/234 (26%)
Tryp_SPc 57..277 CDD:238113 62/234 (26%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 61/238 (26%)
Tryp_SPc 34..253 CDD:238113 63/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.