DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:276 Identity:80/276 - (28%)
Similarity:126/276 - (45%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDAE------CGRSLPTNAKLTWWNYFDSSTDIQAN-PWIVSVIVNGKAKCSGSLINHRFVLTAA 84
            :|||      |||....:|  |:......||..:.. ||..|:.||||..|..|||..||:||||
Mouse   162 VDAEKIINNRCGRRPRMSA--TYDRITGGSTAHKGEWPWQASLRVNGKHYCGASLIGERFLLTAA 224

  Fly    85 HCVFREAMQVHLGDFDAWNPGQN--CSSGARLSNAYCVR-IDKKIVHAGFGKIQAQQYDIGLLRM 146
            ||            |...|..:|  .|.|.|::.||... :.:.|:|..:.|.:... |:.::::
Mouse   225 HC------------FQGTNNPKNLTVSFGTRVTPAYMQHSVQEIIIHEDYVKGEHHD-DVAVIKL 276

  Fly   147 QHAVQYSDFVRPICL----LINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTL 207
            ...|.:::.|..:||    .|..|...:   .:|.||:.:.:.:| |.:|:.:....||...|..
Mouse   277 TEKVSFNNDVHRVCLPESTQIFPPGEGV---VVTGWGSFSYNGKS-PLLLQKASIKIIDTNTCNS 337

  Fly   208 K--FQQQVDESQICV-HTETS-HACKGDSGGPF----SAKILYGGTYRTFQFGIIIFGLSSCAGL 264
            :  :..::.::.:|. :.|.| .||:||||||.    |..|.|       ..||:.:| ..|..:
Mouse   338 EEAYGGRIVDTMLCAGYLEGSIDACQGDSGGPLVHPNSRDIWY-------LVGIVSWG-HECGRV 394

  Fly   265 S---VCTNVTFYMDWI 277
            :   |...||.|.:||
Mouse   395 NKPGVYMRVTSYRNWI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 68/237 (29%)
Tryp_SPc 57..277 CDD:238113 68/237 (29%)
Tmprss11bNP_795998.2 SEA 46..140 CDD:279699
Tryp_SPc 184..410 CDD:214473 70/250 (28%)
Tryp_SPc 185..413 CDD:238113 72/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.