DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG33127

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:246 Identity:57/246 - (23%)
Similarity:94/246 - (38%) Gaps:51/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVIVNGKA---KCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAY 118
            |::||:.:....   .|..|:|..|::|||||||  :.::...||...........:.:.::.|.
  Fly    54 PYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCV--DELRTFNGDAVGTPVYAGIINRSNVTAAQ 116

  Fly   119 CVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL------LINEPVAAIDRFQLTV 177
            ...:|....|..|.. .|...:|.||.:..:.:|:..|:.|.|      ..|:..||..      
  Fly   117 VRYVDFASTHRSFNG-NAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYG------ 174

  Fly   178 WGTTAEDFRSIPRVLKHSVGDRIDRELC--TLKFQQQVDESQICVHTETSHACKGDSGGPFSAKI 240
            ||.|..|.....:.|:::....::...|  .|.....:...|:|...:|   |.||.|.|    :
  Fly   175 WGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQVKT---CYGDGGTP----L 232

  Fly   241 LYGGTYRTFQFGIIIFGLSSCAGL--------------SVCTNVTFYMDWI 277
            :|..          |.|.:...||              :|.|:|..|:.||
  Fly   233 IYWP----------ITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 55/244 (23%)
Tryp_SPc 57..277 CDD:238113 55/244 (23%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 57/246 (23%)
Tryp_SPc 41..273 CDD:214473 55/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.