DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG31269

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:237 Identity:64/237 - (27%)
Similarity:100/237 - (42%) Gaps:47/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSVI-VNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCV 120
            |:.:|:. ::|...|.|::||..|||||||||           .:|:.|.....:|....|....
  Fly    50 PYQISLQGISGAHSCGGAIINETFVLTAAHCV-----------ENAFIPWLVVVTGTNKYNQPGG 103

  Fly   121 RIDKKIVHAGFGKIQAQQY-DIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAED 184
            |...|.:|........:.: ||.||.:...:.:.:..:||.|.: .|:...|...||.||:|   
  Fly   104 RYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL-VPMQPGDEVILTGWGST--- 164

  Fly   185 FRSIPRVLKHSVGDRIDRELCTLKF------------QQQVDESQICVHTETSH-ACKGDSGGPF 236
                  ||..:  ..||.::..|::            .:..|...||..:.... ||.|||||| 
  Fly   165 ------VLWGT--SPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGP- 220

  Fly   237 SAKILYGGTYRTFQFGIIIFGLSSCAGL-SVCTNVTFYMDWI 277
               ::..|    :..|::.:|.....|: .|..:|.||.|||
  Fly   221 ---LVSNG----YLVGLVNWGWPCATGVPDVHASVYFYRDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 62/235 (26%)
Tryp_SPc 57..277 CDD:238113 62/235 (26%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 62/235 (26%)
Tryp_SPc 38..258 CDD:238113 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.