DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Klk15

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:297 Identity:78/297 - (26%)
Similarity:126/297 - (42%) Gaps:75/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSG 72
            ||:.|..|...:::|...|...||   :|                 .:.||.|::...|:..|..
Mouse     3 LLLAFVLLVSAAQDGDKVLEGEEC---VP-----------------HSQPWQVALFERGRFNCGA 47

  Fly    73 SLINHRFVLTAAHCVFREAMQVHLGD-----FDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFG 132
            .||:.|:|||||||..| .|:|.||:     ||  .|.|..|            :.:.|.|.|: 
Mouse    48 FLISPRWVLTAAHCQTR-FMRVRLGEHNLRKFD--GPEQLRS------------VSRIIPHPGY- 96

  Fly   133 KIQAQQYDIGLLRMQHAVQYSDFVRPI-----CLLINEPVAAIDRFQLTVWGTTAED-------- 184
            :.:..::||.|||:....:.:.:|||:     |.||.|...      ::.||..:::        
Mouse    97 EARTHRHDIMLLRLFKPARLTAYVRPVALPRRCPLIGEDCV------VSGWGLLSDNNPGATGSQ 155

  Fly   185 --FRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTE--TSHACKGDSGGPFSAKILYGGT 245
              ...:|..|..:....|....|...:..:|..:.:|...|  .:.:|:||||||    ::.||.
Mouse   156 KSHVRLPDTLHCANISIISEASCNKDYPGRVLPTMVCAGVEGGGTDSCEGDSGGP----LVCGGA 216

  Fly   246 YRTFQFGIIIFGLSSCAGLS---VCTNVTFYMDWIWD 279
            .:    ||:.:|...|...:   |.|.|..|::|||:
Mouse   217 LQ----GIVSWGDVPCDTTTKPGVYTKVCSYLEWIWE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 66/244 (27%)
Tryp_SPc 57..277 CDD:238113 66/244 (27%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 69/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.