DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Prss30

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:246 Identity:73/246 - (29%)
Similarity:103/246 - (41%) Gaps:47/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWIVSV-IVNGKAKCSGSLINHRFVLTAAHCVFREAM-----QVHLGDFDAWNPGQNCSSGARLS 115
            ||.||: |......|.||||:..:||||||| ||.::     .|.:|             |..||
Mouse    86 PWQVSLWITEDGHICGGSLIHEVWVLTAAHC-FRRSLNPSFYHVKVG-------------GLTLS 136

  Fly   116 ----NAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL-LINEPVAAIDRFQL 175
                ::..|.:....||..:....|...||.|:::...::.|.|. |:|| ....|:.......:
Mouse   137 LLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFT-PVCLPAAQTPLTPGTVCWV 200

  Fly   176 TVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQ---------VDESQICV-HTE-TSHACK 229
            |.||.|.|  |.:..||:......:|.|.|...:..|         :....:|. :.| ...:|:
Mouse   201 TGWGATQE--RDMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGYVEGQKDSCQ 263

  Fly   230 GDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA---GLSVCTNVTFYMDWI 277
            ||||||....|....|    |.||..:|: .||   ...|.|.|..|:|||
Mouse   264 GDSGGPLVCSINSSWT----QVGITSWGI-GCARPYRPGVYTRVPTYVDWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 71/244 (29%)
Tryp_SPc 57..277 CDD:238113 71/244 (29%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 73/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.