DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Klk8

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:287 Identity:66/287 - (22%)
Similarity:109/287 - (37%) Gaps:61/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAK 69
            |...|::.|...|...:||..|...||                    ...:.||..::....:..
  Rat    13 ILLFLLMGAWAGLTRAQGSKILEGQEC--------------------KPHSQPWQTALFQGERLV 57

  Fly    70 CSGSLINHRFVLTAAHCVFREAMQVHLGDFDAW---NPGQNCSSGARLSNAYCVRIDKKIVHAGF 131
            |.|.|:..|:|||||||. ::...|.|||....   .|.|.            :::.:.|.|..|
  Rat    58 CGGVLVGDRWVLTAAHCK-KDKYSVRLGDHSLQKRDEPEQE------------IQVARSIQHPCF 109

  Fly   132 GKIQAQ--QYDIGLLRMQHAVQYSDFVRPI-----CLLINEPVAAIDRFQLTVWGTTAEDFRSIP 189
            .....:  .:||.|:|:|::....|.|:||     |..:.:      :..::.|||......:.|
  Rat   110 NSSNPEDHSHDIMLIRLQNSANLGDKVKPIELANLCPKVGQ------KCIISGWGTVTSPQENFP 168

  Fly   190 RVLKHSVGDRIDRELCTLKFQQQVDESQICVHTET-SHACKGDSGGPFSAKILYGGTYRTFQFGI 253
            ..|..:......:..|...:..::.|..:|..:.. :..|:||||||    ::..|..:    ||
  Rat   169 NTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGP----LVCNGVLQ----GI 225

  Fly   254 IIFGLSSCA---GLSVCTNVTFYMDWI 277
            ..:|...|.   ...|.|.:..|.:||
  Rat   226 TSWGSDPCGKPEKPGVYTKICRYTNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 55/233 (24%)
Tryp_SPc 57..277 CDD:238113 55/233 (24%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 58/266 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.