powered by:
Protein Alignment CG14227 and Pik3ip1
DIOPT Version :9
Sequence 1: | NP_608345.2 |
Gene: | CG14227 / 32978 |
FlyBaseID: | FBgn0031058 |
Length: | 286 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001382087.1 |
Gene: | Pik3ip1 / 305472 |
RGDID: | 1311203 |
Length: | 267 |
Species: | Rattus norvegicus |
Alignment Length: | 53 |
Identity: | 13/53 - (24%) |
Similarity: | 20/53 - (37%) |
Gaps: | 13/53 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 IVHAGFGKIQAQQYDIGL-LRMQH------------AVQYSDFVRPICLLINE 165
|:..|.|.:....|..|. |:.|| .:..|.|..|.|.:::|
Rat 185 IIAIGVGIVLGYTYKRGKDLKEQHEQKVCEREMQRITLPLSAFTNPTCEIMDE 237
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166336777 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.