DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Prss22

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:300 Identity:83/300 - (27%)
Similarity:133/300 - (44%) Gaps:59/300 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VIAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKA 68
            ::..||...|::...:..||     .:||:....|..:..    :.|.|.|. |||||::.||..
  Rat    19 ILLVLLTSTATVSAANIRGS-----PDCGKPQQLNRVVGG----EDSADAQW-PWIVSILKNGSH 73

  Fly    69 KCSGSLINHRFVLTAAHCVFREAM------QVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIV 127
            .|:|||:.:|:|::|||| |...|      .|.||.:...|||.....         |.|...:.
  Rat    74 HCAGSLLTNRWVVSAAHC-FSSNMDKPSPYSVLLGAWKLGNPGPRSQK---------VGIASVLP 128

  Fly   128 HAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAI-----DRFQLTVWGTTAEDFRS 187
            |..:.:.:....||.|:|::..:|:|:.:.||||    |.:::     ....:..|| :.:|...
  Rat   129 HPRYSRKEGTHADIALVRLERPIQFSERILPICL----PDSSVHLPPNTNCWIAGWG-SIQDGVP 188

  Fly   188 IPR-----VLKHSVGDRIDRELCTLKF-----QQQVDESQICV-HTETSH-ACKGDSGGPFSAKI 240
            :||     .||..:   ||.|||...:     |:.:.|..:|. :.|... ||.||||||...::
  Rat   189 LPRPQTLQKLKVPI---IDPELCKSLYWRGAGQEAITEDMLCAGYLEGKRDACLGDSGGPLMCQV 250

  Fly   241 LYGGTYRTFQFGIIIFGLSSCAGLS---VCTNVTFYMDWI 277
                .......|||.:| ..||..:   |.|::..:..|:
  Rat   251 ----DDHWLLTGIISWG-EGCAERNRPGVYTSLLAHRPWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 71/245 (29%)
Tryp_SPc 57..277 CDD:238113 71/245 (29%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 74/263 (28%)
Tryp_SPc 50..288 CDD:238113 75/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.