DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and GZMK

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:241 Identity:63/241 - (26%)
Similarity:106/241 - (43%) Gaps:31/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFR----EAMQVHLGDFDAWNPGQNCSSGARLS 115
            :.|::.|:...|...|.|.||:.::|||||||.:|    ::..|.||   |.:..:|.:|...|.
Human    37 SRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLG---AHSLSKNEASKQTLE 98

  Fly   116 NAYCVRIDKKIVHAGFGKIQA--QQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVW 178
                   .||.:  .|.::.:  |..||.|:::|.|.:.:..|:.:.:.....:.:..:.::|.|
Human    99 -------IKKFI--PFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGW 154

  Fly   179 GTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVD----ESQICVHTETSH--ACKGDSGGPFS 237
            |.|..|.......|:......:.|:||..:.....|    :..:|.......  :||||||||..
Human   155 GATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLI 219

  Fly   238 AKILYGGTYRTFQFGIIIFGLSSCAGLSVCTNVT-FYMDWIWDALV 282
            .|    |.:.....|....|:::..|  :.|.:| .|..||...||
Human   220 CK----GVFHAIVSGGHECGVATKPG--IYTLLTKKYQTWIKSNLV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 59/232 (25%)
Tryp_SPc 57..277 CDD:238113 59/232 (25%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 59/234 (25%)
Tryp_SPc 27..257 CDD:238113 61/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.