DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and GZMA

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:235 Identity:55/235 - (23%)
Similarity:91/235 - (38%) Gaps:64/235 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYC 119
            :.|::|.:.::.|..|:|:||...:|||||||...:..||.||          ..|..|......
Human    39 SRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILG----------AHSITREEPTKQ 93

  Fly   120 VRIDKKIVHAGFGKIQAQQYDIGLLRMQ------------HAVQYSDFVRP--ICLLINEPVAAI 170
            :.:.||...........::.|:.||::.            |..:..|.|:|  :|          
Human    94 IMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMC---------- 148

  Fly   171 DRFQLTVWGTT------AEDFRSIPRVLKHSVGDRIDRELCT----LKFQQQVDESQICVHTETS 225
               |:..||.|      ::..|.:...:       |||::|.    ..|...:..:.:|..:...
Human   149 ---QVAGWGRTHNSASWSDTLREVNITI-------IDRKVCNDRNHYNFNPVIGMNMVCAGSLRG 203

  Fly   226 --HACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCAG 263
              .:|.||||.|    :|..|.:|    |:..|||.:..|
Human   204 GRDSCNGDSGSP----LLCEGVFR----GVTSFGLENKCG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 55/233 (24%)
Tryp_SPc 57..277 CDD:238113 55/233 (24%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 55/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.