DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Gzmm

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus


Alignment Length:246 Identity:62/246 - (25%)
Similarity:98/246 - (39%) Gaps:54/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHL-----GDFDAWNPGQNCSSGARL 114
            :.|::||:.......|.|.|::.::|||||||:.....|:.|     ...|..:||         
  Rat    37 SRPYMVSLQNTKSHVCGGVLVHQKWVLTAAHCLSEPLQQLKLVFGLHSLHDPQDPG--------- 92

  Fly   115 SNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL--LINEPVAAIDRFQLTV 177
               ....|.:.|.|.|:.  ...:.|:.||::...|:.|..|:|:.|  ...:..|...|.....
  Rat    93 ---LTFYIKQAIKHPGYN--LKYENDLALLKLDGRVKPSKNVKPLALPRKPRDKPAEGSRCSTAG 152

  Fly   178 WGTT------AEDFRSIPRVLKHSVGDRIDRELC-TLKFQQQV-DESQICVH--TETSHACKGDS 232
            ||.|      |:..:.:...|       :|..:| ..:|...| .:|.:|:.  .:....|||||
  Rat   153 WGITHQRGQLAKSLQELDLRL-------LDTRMCNNSRFWNGVLTDSMLCLKAGAKGQAPCKGDS 210

  Fly   233 GGPF---SAKILYGGTYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWI 277
            |||.   ..|:          .||:.|...:|..:   :|.|.|..|..||
  Rat   211 GGPLVCGKGKV----------DGILSFSSKNCTDIFKPTVATAVAPYSSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/242 (25%)
Tryp_SPc 57..277 CDD:238113 60/242 (25%)
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 62/246 (25%)
Trypsin 27..251 CDD:278516 60/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.