DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and F10

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:264 Identity:71/264 - (26%)
Similarity:110/264 - (41%) Gaps:56/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ECGR-SLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFR-EAM 92
            ||.| ..|..|.|    :.|..||               ..|.|:::|..::||||||:.: :..
  Rat   237 ECKRGECPWQALL----FSDEETD---------------GFCGGTILNEFYILTAAHCLHQAKRF 282

  Fly    93 QVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVR 157
            :|.:||.   |..|  ..|..:.:    .:|..|.|..|.: ....:||.:||::..:.:.:.|.
  Rat   283 KVRVGDL---NTEQ--EDGGEMVH----EVDMIIKHNKFQR-DTYDFDIAMLRLKTPITFRENVA 337

  Fly   158 PICL---------LINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQV 213
            |.||         |:.:....:..|     |.|.|..|. .:|||......:||..|.|.....:
  Rat   338 PACLPQKDWAEATLMTQKTGIVSGF-----GRTHEKGRQ-SKVLKMMEVPYVDRNTCRLSTSFSI 396

  Fly   214 DESQICV--HTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA---GLSVCTNVTFY 273
            .::..|.  ..:...||:||||||...:  :..||  |..||:.:| ..||   ...:.|.||.:
  Rat   397 TQNMFCAGYDAKQEDACQGDSGGPHVTR--FKDTY--FVTGIVSWG-EGCARKGKYGIYTKVTAF 456

  Fly   274 MDWI 277
            :.||
  Rat   457 LKWI 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/234 (26%)
Tryp_SPc 57..277 CDD:238113 60/234 (26%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372
Tryp_SPc 232..462 CDD:238113 71/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.