DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Habp2

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001001505.2 Gene:Habp2 / 292126 RGDID:1302979 Length:558 Species:Rattus norvegicus


Alignment Length:284 Identity:76/284 - (26%)
Similarity:129/284 - (45%) Gaps:41/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGSREGSAFLLDA--ECGRS-LPTNAKLTWWNYFDSSTDIQANPWIVSV-----IVNGKAK---C 70
            |||.:.....|..  .||:: :..:|....:..|.|:..  .:||.||:     :.....:   |
  Rat   283 LGSLQEPVMELPGFDSCGKTEMTEHAVKRIYGGFKSTAG--KHPWQVSLQTSLPLTTSMPQGHFC 345

  Fly    71 SGSLINHRFVLTAAHC--VFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFG- 132
            .||||:..:|||||||  :..:.::|.|||.|.....         |:....|::|.:.::.:. 
  Rat   346 GGSLIHPCWVLTAAHCTDMSTKHLKVVLGDQDLKKTE---------SHEQTFRVEKILKYSQYNE 401

  Fly   133 KIQAQQYDIGLLRMQ----HAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLK 193
            :.:....||.||:::    |....|.:|:.:| |.::|..:.....::.||.|.....|  |.|.
  Rat   402 RDEIPHNDIALLKLKPVGGHCALESKYVKTVC-LPSDPFPSGTECHISGWGVTETGEGS--RQLL 463

  Fly   194 HSVGDRIDRELCTLK--FQQQVDESQIC---VHTETSHACKGDSGGPFSAKILYGGTYRTFQFGI 253
            .:....|...||..:  :...:|:|.||   :....|..|:||||||.:.:  ..|||  :.:||
  Rat   464 DAKVKLIANALCNSRQLYDHTIDDSMICAGNLQKPGSDTCQGDSGGPLTCE--KDGTY--YVYGI 524

  Fly   254 IIFGLSSCAGLSVCTNVTFYMDWI 277
            :.:|........|.|.||.:::||
  Rat   525 VSWGQECGKKPGVYTQVTKFLNWI 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 65/239 (27%)
Tryp_SPc 57..277 CDD:238113 65/239 (27%)
Habp2NP_001001505.2 EGF_CA 71..107 CDD:238011
KR 191..275 CDD:238056
Tryp_SPc 312..551 CDD:238113 69/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.