DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Gzmk

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:289 Identity:73/289 - (25%)
Similarity:121/289 - (41%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKC 70
            :||:.|.|.:::.|   .:|..:...||.:..:::                |::.|:...||..|
  Rat     6 SALVFLVAGIYMSS---ESFHTEIIGGREVQPHSR----------------PFMASIQYRGKHIC 51

  Fly    71 SGSLINHRFVLTAAHCVFR-EAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKI 134
            .|.||:.::|||||||..| .:..|.||       ..:.|....:...:  .|.:.|..:||   
  Rat    52 GGVLIHPQWVLTAAHCYSRGHSPTVVLG-------AHSLSKNEPMKQTF--EIKEFIPFSGF--- 104

  Fly   135 QAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDR 199
            ::...||.|::::.|.:.:..|:.:.|.....:....:.|:|.||:|..|..:....|:......
  Rat   105 KSGTNDIMLIKLRTAAELNKHVQLLHLRSKNYIRDGTKCQVTGWGSTKPDVLTTSDTLQEVTVTI 169

  Fly   200 IDRELCT----LKFQQQVDESQICVHTETSH--ACKGDSGGPFSAKILYGGTYRTFQFGIIIFGL 258
            |.|:.|.    ...:..:.:..||.......  :||||||||...|    |.:.....|....|:
  Rat   170 ISRKRCNSQSYYNHKPVITKDMICAGDRRGEKDSCKGDSGGPLICK----GVFHALVSGGYKCGI 230

  Fly   259 SSCAGLSVCTNVT-FYMDWIWDALVNLSA 286
            |:..|  |.|.:| .|..||...|...||
  Rat   231 SNKPG--VYTLLTKKYQTWIKSKLAPSSA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 60/227 (26%)
Tryp_SPc 57..277 CDD:238113 60/227 (26%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 62/256 (24%)
Tryp_SPc 26..251 CDD:238113 64/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.