DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Prss38

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:281 Identity:74/281 - (26%)
Similarity:113/281 - (40%) Gaps:55/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFLGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHRF 79
            |||.|..|...|.....|..|..:.|   |            ||.||:...|...|.||::|..:
  Rat    99 LFLSSACGQPALHGKLLGGELTIDRK---W------------PWQVSIHYAGFHVCGGSILNAYW 148

  Fly    80 VLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLL 144
            |||||||..||.   .|..||.:....|.....:.:..:  .|::.|:|..|........|:.|:
  Rat   149 VLTAAHCFAREK---RLQTFDMYVGITNLEVANKHTQWF--EINQVIIHPTFEMFHPVGGDVALV 208

  Fly   145 RMQHAVQYSDFVRPICLLINEPVAAIDRFQLTVW----------GTTAEDF--RSIPRVLKHSVG 197
            :.:.|:.:||:|.||||    |.:.::...|:.|          |.|.:|.  ..:|.:.|..  
  Rat   209 QSKSAIVFSDYVLPICL----PSSNLNLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQ-- 267

  Fly   198 DRIDRELCTLKF--QQQVDESQICVH--TETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGL 258
                   |.|.:  ...:....:|..  ....:.|:||||.|...|:    .....|.||:.:|.
  Rat   268 -------CQLLYGLTSYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKV----NQTWLQIGIVSWGR 321

  Fly   259 SSCAGL--SVCTNVTFYMDWI 277
            .....|  .|..||:::::||
  Rat   322 GCAQPLYPGVFANVSYFLNWI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 62/237 (26%)
Tryp_SPc 57..277 CDD:238113 62/237 (26%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 68/264 (26%)
Tryp_SPc 116..342 CDD:214473 66/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.