DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and KLK9

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:252 Identity:61/252 - (24%)
Similarity:104/252 - (41%) Gaps:57/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAW---NPGQNCSSGARLSN 116
            :.||...:....:..|..:||:.|::|||||| .:..:.|.||:...|   .|.|          
Human    33 SQPWQAGLFHLTRLFCGATLISDRWLLTAAHC-RKPYLWVRLGEHHLWKWEGPEQ---------- 86

  Fly   117 AYCVRIDKKIVHAGFGK-IQAQQY--DIGLLRMQHAVQYSDFVRPI------------CLLINEP 166
              ..|:.....|.||.| :.|..:  ||.|:|:....:.|..|:|:            ||     
Human    87 --LFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPGMQCL----- 144

  Fly   167 VAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQIC--VHTETSHACK 229
                    ::.||..:......|..|:.:....::.:||...:...:.:|.:|  :......:|:
Human   145 --------ISGWGAVSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQ 201

  Fly   230 GDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA---GLSVCTNVTFYMDWIWDALVN 283
            ||||||    ::..||..    |::..|...|:   ..:|.|:|..|:|||.:.:.|
Human   202 GDSGGP----LVCNGTLA----GVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEIMEN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 58/242 (24%)
Tryp_SPc 57..277 CDD:238113 58/242 (24%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 60/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.