DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG18420

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:295 Identity:83/295 - (28%)
Similarity:122/295 - (41%) Gaps:63/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAALLILFASLFLGSREGSAFLLDAECGRSLP-------TNAKLTWWNYFDSSTDIQANPWIVSV 62
            |..||.:|..|      ||...||:|||...|       .|.|:...|         ::||:..:
  Fly    11 ILLLLTVFPLL------GSTQFLDSECGTRSPLKLGPRIVNGKVAVRN---------SSPWMAFL 60

  Fly    63 -IVNGKAKCSGSLINHRFVLTAAHC-VFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKK 125
             ..:.:..|.|:||:.|.||||||| :....:.|.||:::....|..  ...:::..:..|....
  Fly    61 HTSSNQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYR--EEHQVNRTFQHRFYDP 123

  Fly   126 IVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLIN----EPVAAIDRFQLTVWGTTAEDFR 186
            ..||.         ||.|||:...|.|...:||||::.:    ..:.:|.....|.||.|     
  Fly   124 NTHAN---------DIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRT----- 174

  Fly   187 SIPRVLKHSVGDRIDRELCTLKFQQQ---------VDESQICVHTETSHACKGDSGGPFSAKILY 242
                   .|:.|  ..||.||...:|         |..:|.|.....|:.|.||:|||..|.:.|
  Fly   175 -------ESMHD--SSELRTLDISRQPSKMCAFGSVLSNQFCAGNWNSNLCIGDTGGPVGAMVRY 230

  Fly   243 GGTYRTFQFGIIIFGLSSCAGLSVCTNVTFYMDWI 277
            ...:|..|.||.|.. ..|...||.|:|..::::|
  Fly   231 RNAFRFVQVGIAITN-KRCQRPSVFTDVMSHIEFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 66/234 (28%)
Tryp_SPc 57..277 CDD:238113 66/234 (28%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 69/256 (27%)
Tryp_SPc 43..267 CDD:238113 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.