DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG33225

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:282 Identity:108/282 - (38%)
Similarity:154/282 - (54%) Gaps:18/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VIAALLILFASLFLGSREGSAFLLDAECGRSL-PTNAKLTWWNYFDSSTDIQANPWIVSVIVNGK 67
            :..|.::|.|||.||:|.||:.||..:||.:. |:..:..   ...:..|..||||:|.|:....
  Fly    18 IFVAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRV---VGGNDADRFANPWMVMVLGENN 79

  Fly    68 AKCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFG 132
            ..||||||...||||:|.|:.....||.||::|     :||:|....|....:.||:||:|..||
  Fly    80 VFCSGSLITRLFVLTSASCLLSLPKQVILGEYD-----RNCTSADCTSIRQVIDIDQKIIHGQFG 139

  Fly   133 KIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVA-AIDRFQLTVWGTTAEDFRSIPRVLKHSV 196
            ....::|||.|||:...|..||:||||||.::..|. ::..|..|.||||  ::.....:|:...
  Fly   140 LETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTT--EWNEPSTILQTVT 202

  Fly   197 GDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGG------TYRTFQFGIII 255
            ..:|:|:.|..:.:|.:|.||:||.......|.||:|||.|..:...|      ..|.|..||:.
  Fly   203 LSKINRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVS 267

  Fly   256 FGLSSCAGLSVCTNVTFYMDWI 277
            :|.|||:|:.|.|||..|||||
  Fly   268 YGSSSCSGIGVYTNVEHYMDWI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 88/226 (39%)
Tryp_SPc 57..277 CDD:238113 88/226 (39%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 91/242 (38%)
Tryp_SPc 57..292 CDD:238113 93/243 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.