DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and CG33226

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:295 Identity:95/295 - (32%)
Similarity:141/295 - (47%) Gaps:34/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILFASLFLGSREG-SAFLLDAECGRSLPTNAK---LTWWNYFDSSTDIQANPWIVSVIVNGKA 68
            ||:.|. |.|.|.|. ...|||..|.:: |...:   |...|     .||:.:||:|.::..|..
  Fly    13 LLVCFI-LALRSYESLGQDLLDPNCVQT-PVGVREQILGGHN-----ADIKLHPWMVQILQRGYH 70

  Fly    69 KCSGSLINHRFVLTAAHCVFREAMQVHLGDFDAWNPGQNCSSGARLSNAYC------VRIDKKIV 127
            .|.||||:..||||||||..|..::|..|.:....|...|||      .||      :.:.:..:
  Fly    71 FCGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSS------QYCSPFGPEIDVKRIFL 129

  Fly   128 HAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLL-------INEPVAAIDRFQLTVWGTTAEDF 185
            |:.:.  ....|||.|..:...|:|:...||||:|       :.:.:..:..|.:|.||.|....
  Fly   130 HSSYR--DYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQL 192

  Fly   186 RSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQ 250
            .|  .:|:.:....:||:.|...|.:::....||.....|..|.||||||.||::.:.|..||..
  Fly   193 TS--TILQTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVL 255

  Fly   251 FGIIIFGLSSCAGLSVCTNVTFYMDWIWDALVNLS 285
            ||||.:|..:|..::|.|||..|.:||.|.:.|.:
  Fly   256 FGIISYGAPNCREVTVFTNVLRYSNWIRDIVHNFT 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 75/232 (32%)
Tryp_SPc 57..277 CDD:238113 75/232 (32%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 81/252 (32%)
Tryp_SPc 47..282 CDD:214473 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.