DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Gzma

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:253 Identity:64/253 - (25%)
Similarity:99/253 - (39%) Gaps:68/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCVFREAMQVHLGDFD-AWNPGQNCSSGARLSNAY 118
            :.|::|.:.:...:.|:|:||...:|||||||:..:..:|.||... ...|.|...|   :..||
  Rat    39 SRPYMVLLKLKPDSICAGALIAKNWVLTAAHCIPGKKSEVILGAHSIKKEPEQQILS---VKKAY 100

  Fly   119 CVRIDKKIVHAGFGKIQAQQYDIGLLRMQ------------HAVQYSDFVRPICLLINEPVAAID 171
            ......|..|.|         |:.|||::            |..:..|.|:|           ..
  Rat   101 PYPCFDKHTHEG---------DLQLLRLKKKATLNKNVAILHLPKKGDDVKP-----------GT 145

  Fly   172 RFQLTVWG------TTAEDFRSIPRVLKHSVGDRIDRELCT----LKFQQQVDESQICVHT--ET 224
            |..:..||      ..::..|.:...:       |||::|.    ..|...:..:.||...  ..
  Rat   146 RCHVAGWGRFHNKSPPSDTLREVNITV-------IDRKICNDEKHYNFNPVIGLNMICAGNLRGG 203

  Fly   225 SHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSS-CA---GLSVCTNVT-FYMDWI 277
            ..:|.||||||    :|..|.:|    ||..|||.. |.   |..:.|.:: .::|||
  Rat   204 KDSCYGDSGGP----LLCEGIFR----GITAFGLEGRCGDPKGPGIYTLLSDKHLDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 62/249 (25%)
Tryp_SPc 57..277 CDD:238113 62/249 (25%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 62/251 (25%)
Tryp_SPc 29..256 CDD:238113 64/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.