DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14227 and Prss45

DIOPT Version :9

Sequence 1:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:312 Identity:79/312 - (25%)
Similarity:120/312 - (38%) Gaps:82/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILFASLF-------LGSREGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVN 65
            :||.||:|.       ||..|.   ..:..||        ..||.  |:..:....||..|:.:.
Mouse    19 ILICFAALLLLPPRPNLGYNEN---YTEPVCG--------TPWWP--DNLEESHHWPWEASLQIE 70

  Fly    66 GKAKCSGSLINHRFVLTAAHCV-FREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHA 129
            .|..|.|:||:..:|::||||: ..:...|.||.......|.        |....:.:...|:|.
Mouse    71 DKHVCGGALIDRSWVVSAAHCIQGNKEYSVMLGSSTLHPNGS--------SWTLKIPVGDIIIHP 127

  Fly   130 GFGKIQAQQYDIGLLRMQHAVQYSDFVRPICL---LINEPVAAIDRFQLTVWGTTAEDFRSIPRV 191
            .:......:.||.||.::..|.::.:|:||||   ..|..|..  :..:|.||          :|
Mouse   128 KYWGRNFIRSDIALLCLETPVTFNKYVQPICLPEHNFNFKVGT--KCWVTGWG----------QV 180

  Fly   192 LKHSVGDR-------------IDRELCTLKFQQQ---------VDESQICVHTETSHACKGDSGG 234
            .:||....             ||.:.|...|.::         :.::.||........|.||.||
Mouse   181 KQHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGEDLCYGDPGG 245

  Fly   235 PFSAKILYGGTYRTFQFGIIIFGLSS----CA---GLSVCTNVTFYMDWIWD 279
            |.:.:|  .|.:       |:.|:.|    ||   .|||.|.:|.|..||.|
Mouse   246 PLACEI--DGRW-------ILAGVFSWEKACATVPNLSVYTRITKYTIWIKD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/252 (25%)
Tryp_SPc 57..277 CDD:238113 63/252 (25%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 66/259 (25%)
Tryp_SPc 59..286 CDD:214473 63/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.